Rabbit anti-Human SRSF7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09106P

• Product Name:
• Rabbit anti-Human SRSF7 Polyclonal Antibody

• Synonym:
• 9G8; AAG3; SFRS7; SRSF7

• Description:
• The antibody against SRSF7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human SRSF7 (NP_001026854) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human SRSF7 (NP_001026854).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SRSF7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH

• Gene ID:
• 6432

• Uniprot-ID:
• Q16629

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Mouse brain, Mouse kidney, Rat brain, Rat kidney