Rabbit anti-Human SRSF2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11242P

• Product Name:
• Rabbit anti-Human SRSF2 Polyclonal Antibody

• Synonym:
• SC35; PR264; SC-35; SFRS2; SFRS2A; SRp30b; SRSF2

• Description:
• The antibody against SRSF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF2 (NP_001182356.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF2 (NP_001182356.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SRSF2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHH

• Gene ID:
• 6427

• Uniprot-ID:
• Q01130

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung, Raji, THP-1