Rabbit anti-Human SMG6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10899P

• Product Name:
• Rabbit anti-Human SMG6 Polyclonal Antibody

• Synonym:
• EST1A; SMG-6; hEST1A; C17orf31; hSMG5/7a; SMG6

• Description:
• The antibody against SMG6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1160-1419 of human SMG6 (NP_060045.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1419 of human SMG6 (NP_060045.4).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SMG6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PDTMGKEMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDHSQMRQMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG

• Gene ID:
• 23293

• Uniprot-ID:
• Q86US8

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Jurkat, SW620, Rat liver