Rabbit anti-Human SMEK1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01244P

• Product Name:
• Rabbit anti-Human SMEK1 Polyclonal Antibody

• Synonym:
• smk1; FLFL1; PP4R3; SMEK1; smk-1; PP4R3A; MSTP033; KIAA2010

• Description:
• The antibody against SMEK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 395-594 of human SMEK1 (NP_001271210.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 395-594 of human SMEK1 (NP_001271210.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SMEK1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDS

• Gene ID:
• 55671

• Uniprot-ID:
• Q6IN85

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, HepG2, Jurkat, MCF-7, Mouse spleen, Rat brain