Rabbit anti-Human SMARCB1/SNF5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07894P

• Product Name:
• Rabbit anti-Human SMARCB1/SNF5 Polyclonal Antibody

• Synonym:
• RDT; CSS3; INI1; SNF5; Snr1; BAF47; INI-1; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144; SMARCB1/SNF5

• Description:
• The antibody against SMARCB1/SNF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SMARCB1/SNF5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT

• Gene ID:
• 6598

• Uniprot-ID:
• Q12824

• Purification Method:
• Affinity purification

• Positive Samples:
• SH-SY5Y, THP-1, Hep G2, HeLa, Mouse testis, Rat testis