Rabbit anti-Human Smad6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08279P

• Product Name:
• Rabbit anti-Human Smad6 Polyclonal Antibody

• Synonym:
• AOVD2; MADH6; MADH7; HsT17432; Smad6

• Description:
• The antibody against Smad6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 231-330 of human Smad6 (NP_005576.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 231-330 of human Smad6 (NP_005576.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Smad6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RWPDLQHAVELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSH

• Gene ID:
• 4091

• Uniprot-ID:
• O43541

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, A549