Rabbit anti-Human SLC52A3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10033P

• Product Name:
• Rabbit anti-Human SLC52A3 Polyclonal Antibody

• Synonym:
• RFT2; BVVLS; RFVT3; hRFT2; BVVLS1; C20orf54; bA371L19.1; SLC52A3

• Description:
• The antibody against SLC52A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC52A3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL

• Gene ID:
• 113278

• Uniprot-ID:
• Q9NQ40

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse kidney