Rabbit anti-Human SLC4A4 / NBC Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09711P

• Product Name:
• Rabbit anti-Human SLC4A4 / NBC Polyclonal Antibody

• Synonym:
• KNBC; NBC1; NBC2; pNBC; HNBC1; NBCe1; hhNMC; kNBC1; SLC4A5; NBCe1-A; SLC4A4 / NBC

• Description:
• The antibody against SLC4A4 / NBC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 978-1078 of human SLC4A4 / NBC (NP_001091954.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 978-1078 of human SLC4A4 / NBC (NP_001091954.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC4A4 / NBC

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS

• Gene ID:
• 8671

• Uniprot-ID:
• Q9Y6R1

• Purification Method:
• Affinity purification

• Positive Samples:
• LNCaP, Mouse brain, Rat brain