Rabbit anti-Human SLC3A2/CD98hc Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10564P

• Product Name:
• Rabbit anti-Human SLC3A2/CD98hc Polyclonal Antibody

• Synonym:
• 4F2; CD98; MDU1; 4F2HC; 4T2HC; NACAE; CD98HC; SLC3A2/CD98hc

• Description:
• The antibody against SLC3A2/CD98hc was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 461-630 of human SLC3A2/CD98hc (NP_002385.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 461-630 of human SLC3A2/CD98hc (NP_002385.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC3A2/CD98hc

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA

• Gene ID:
• 6520

• Uniprot-ID:
• P08195

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji, HeLa, Rat lung