Rabbit anti-Human SLC39A8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07990P

• Product Name:
• Rabbit anti-Human SLC39A8 Polyclonal Antibody

• Synonym:
• ZIP8; CDG2N; PP3105; BIGM103; LZT-Hs6; SLC39A8

• Description:
• The antibody against SLC39A8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC39A8 (NP_071437.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC39A8 (NP_071437.3).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC39A8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVI

• Gene ID:
• 64116

• Uniprot-ID:
• Q9C0K1

• Purification Method:
• Affinity purification

• Positive Samples:
• U-937, Rat liver