Rabbit anti-Human SLC39A7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04137P

• Product Name:
• Rabbit anti-Human SLC39A7 Polyclonal Antibody

• Synonym:
• KE4; AGM9; HKE4; ZIP7; RING5; H2-KE4; D6S115E; D6S2244E; SLC39A7

• Description:
• The antibody against SLC39A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 235-380 of human SLC39A7 (NP_008910.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 235-380 of human SLC39A7 (NP_008910.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC39A7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQA

• Gene ID:
• 7922

• Uniprot-ID:
• Q92504

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, A-431, LO2, HeLa, Mouse heart, Mouse pancreas, Mouse liver, Rat heart