Rabbit anti-Human SLC32A1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06305P

• Product Name:
• Rabbit anti-Human SLC32A1 Polyclonal Antibody

• Synonym:
• VGAT; VIAAT; SLC32A1

• Description:
• The antibody against SLC32A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SLC32A1 (NP_542119.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SLC32A1 (NP_542119.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC32A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE

• Gene ID:
• 140679

• Uniprot-ID:
• Q9H598

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, U-251MG, Mouse brain, Mouse pancreas, Mouse liver