Rabbit anti-Human SLC28A2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10009P

• Product Name:
• Rabbit anti-Human SLC28A2 Polyclonal Antibody

• Synonym:
• CNT2; HCNT2; SPNT1; HsT17153; SLC28A2

• Description:
• The antibody against SLC28A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC28A2 (NP_004203.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC28A2 (NP_004203.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC28A2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GAFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDI

• Gene ID:
• 9153

• Uniprot-ID:
• O43868

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, 293T, HT-29, BxPC-3, Mouse heart, Mouse spleen, Rat liver, Rat heart