Rabbit anti-Human SLC27A6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08225P

• Product Name:
• Rabbit anti-Human SLC27A6 Polyclonal Antibody

• Synonym:
• SLC27A6; ACSVL2; FACVL2; FATP6; VLCS-H1; solute carrier family 27 member 6

• Description:
• The antibody against SLC27A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 506-600 of human SLC27A6 (NP_054750.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 506-600 of human SLC27A6 (NP_054750.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC27A6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKS

• Gene ID:
• 28965

• Uniprot-ID:
• Q9Y2P4

• Purification Method:
• Affinity purification