Rabbit anti-Human SLC25A16 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04372P

• Product Name:
• Rabbit anti-Human SLC25A16 Polyclonal Antibody

• Synonym:
• GDA; GDC; ML7; hML7; HGT.1; D10S105E; SLC25A16

• Description:
• The antibody against SLC25A16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC25A16 (NP_689920.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC25A16 (NP_689920.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC25A16

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• APYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL

• Gene ID:
• 8034

• Uniprot-ID:
• P16260

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse kidney, Rat brain, Rat kidney