Rabbit anti-Human SLC22A5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05456P

• Product Name:
• Rabbit anti-Human SLC22A5 Polyclonal Antibody

• Synonym:
• CDSP; OCTN2; SLC22A5

• Description:
• The antibody against SLC22A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-142 of human SLC22A5 (O76082) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 42-142 of human SLC22A5 (O76082).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC22A5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LIATPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDWKA

• Gene ID:
• 6584

• Uniprot-ID:
• O76082

• Purification Method:
• Affinity purification

• Positive Samples:
• HT-29, Mouse testis