Rabbit anti-Human SLC16A4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09830P

• Product Name:
• Rabbit anti-Human SLC16A4 Polyclonal Antibody

• Synonym:
• MCT4; MCT5; SLC16A4

• Description:
• The antibody against SLC16A4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 388-487 of human SLC16A4 (NP_004687.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 388-487 of human SLC16A4 (NP_004687.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC16A4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT

• Gene ID:
• 9122

• Uniprot-ID:
• O15374

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG