Rabbit anti-Human SLAMF7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00200P

• Product Name:
• Rabbit anti-Human SLAMF7 Polyclonal Antibody

• Synonym:
• 19A; CS1; CD319; CRACC; SLAMF7

• Description:
• The antibody against SLAMF7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-226 of human SLAMF7 (NP_067004.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 23-226 of human SLAMF7 (NP_067004.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLAMF7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

• Gene ID:
• 57823

• Uniprot-ID:
• Q9NQ25

• Purification Method:
• Affinity purification

• Positive Samples:
• THP-1, Jurkat, Mouse thymus