Rabbit anti-Human SLAMF6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01436P

• Product Name:
• Rabbit anti-Human SLAMF6 Polyclonal Antibody

• Synonym:
• KALI; NTBA; CD352; KALIb; Ly108; NTB-A; SF2000; SLAMF6

• Description:
• The antibody against SLAMF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-215 of human SLAMF6 (NP_001171643.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-215 of human SLAMF6 (NP_001171643.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLAMF6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCE

• Gene ID:
• 114836

• Uniprot-ID:
• Q96DU3

• Purification Method:
• Affinity purification

• Positive Samples:
• Ramos, Daudi