Rabbit anti-Human SKP2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00009P

• Product Name:
• Rabbit anti-Human SKP2 Polyclonal Antibody

• Synonym:
• p45; FBL1; FLB1; FBXL1; SKP2

• Description:
• The antibody against SKP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human SKP2 (NP_005974.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human SKP2 (NP_005974.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SKP2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHG

• Gene ID:
• 6502

• Uniprot-ID:
• Q13309

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, K-562, HCT116