• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti-Human SIRT3 Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-07697P
  • Product Name:
  • Rabbit anti-Human SIRT3 Polyclonal Antibody
  • Synonym:
  • SIR2L3; SIRT3
  • Description:
  • The antibody against SIRT3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 299-399 of human SIRT3 (NP_036371.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 299-399 of human SIRT3 (NP_036371.1).
  • Species Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • SIRT3
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • PQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
  • Gene ID:
  • 23410
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • HeLa, 293T, Hep G2
  • Pre product:Rabbit anti-Human USP24 Polyclonal Antibody-ADA-07696P
  • Online Inquiry

    refresh