Rabbit anti-Human SIRPG Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03891P

• Product Name:
• Rabbit anti-Human SIRPG Polyclonal Antibody

• Synonym:
• CD172g; SIRPB2; SIRP-B2; bA77C3.1; SIRPgamma; SIRPG

• Description:
• The antibody against SIRPG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-140 of human SIRPG (NP_543006.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 35-140 of human SIRPG (NP_543006.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SIRPG

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEM

• Gene ID:
• 55423

• Uniprot-ID:
• Q9P1W8

• Purification Method:
• Affinity purification

• Positive Samples:
• LO2, A-549, 293T, Mouse liver