Rabbit anti-Human SFTPA1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08503P

• Product Name:
• Rabbit anti-Human SFTPA1 Polyclonal Antibody

• Synonym:
• SPA; ILD1; PSAP; PSPA; SP-A; SPA1; PSP-A; SFTP1; SP-A1; COLEC4; SFTPA1B; SP-A1 beta; SP-A1 delta; SP-A1 gamma; SP-A1 epsilon; SFTPA1

• Description:
• The antibody against SFTPA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-248 of human SFTPA1 (NP_001158116.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 100-248 of human SFTPA1 (NP_001158116.1).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SFTPA1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

• Gene ID:
• 653509729238

• Uniprot-ID:
• Q8IWL2

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat lung