Rabbit anti-Human SEMA4F Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06434P

• Product Name:
• Rabbit anti-Human SEMA4F Polyclonal Antibody

• Synonym:
• S4F; SEMAM; SEMAW; M-SEMA; PRO2353; m-Sema-M; SEMA4F

• Description:
• The antibody against SEMA4F was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-420 of human SEMA4F (NP_004254.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 280-420 of human SEMA4F (NP_004254.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SEMA4F

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RKTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP

• Gene ID:
• 10505

• Uniprot-ID:
• O95754

• Purification Method:
• Affinity purification

• Positive Samples:
• SH-SY5Y, HepG2, A-549, Mouse brain, Mouse liver, Mouse lung, Rat brain, Rat liver