Rabbit anti-Human SEMA4D Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10897P

• Product Name:
• Rabbit anti-Human SEMA4D Polyclonal Antibody

• Synonym:
• A8; GR3; BB18; CD100; COLL4; SEMAJ; coll-4; C9orf164; M-sema-G; SEMA4D

• Description:
• The antibody against SEMA4D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 753-862 of human SEMA4D (NP_006369.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 753-862 of human SEMA4D (NP_006369.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SEMA4D

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YNCYKGYLPRQCLKFRSALLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD

• Gene ID:
• 10507

• Uniprot-ID:
• Q92854

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T