• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti-Human SCNN1B Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-11335P
  • Product Name:
  • Rabbit anti-Human SCNN1B Polyclonal Antibody
  • Synonym:
  • BESC1; ENaCb; SCNEB; LIDLS1; PHA1B2; ENaCbeta; beta-ENaC; beta-NaCH; SCNN1B
  • Description:
  • The antibody against SCNN1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 406-640 of human SCNN1B (NP_000327.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 406-640 of human SCNN1B (NP_000327.2).
  • Species Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • SCNN1B
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • YPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
  • Gene ID:
  • 6338
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • 293T, LO2, Mouse lung
  • Pre product:Rabbit anti-Human MX1 Polyclonal Antibody-ADA-11334P
  • Online Inquiry

    refresh