Rabbit anti-Human SCN3A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01235P

• Product Name:
• Rabbit anti-Human SCN3A Polyclonal Antibody

• Synonym:
• NAC3; DEE62; EIEE62; FFEVF4; Nav1.3; SCN3A

• Description:
• The antibody against SCN3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 274-400 of human SCN3A (NP_008853.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 274-400 of human SCN3A (NP_008853.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SCN3A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RNKCLQWPPSDSAFETNTTSYFNGTMDSNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTY

• Gene ID:
• 6328

• Uniprot-ID:
• Q9NY46

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, HT-1080