Rabbit anti-Human SCG3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10976P

• Product Name:
• Rabbit anti-Human SCG3 Polyclonal Antibody

• Synonym:
• SGIII; SCG3

• Description:
• The antibody against SCG3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 199-468 of human SCG3 (NP_037375.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 199-468 of human SCG3 (NP_037375.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SCG3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL

• Gene ID:
• 29106

• Uniprot-ID:
• Q8WXD2

• Purification Method:
• Affinity purification

• Positive Samples:
• 22Rv1, HepG2, Mouse brain, Mouse lung, Mouse heart, Rat brain, Rat lung, Rat heart