Rabbit anti-Human SCFD1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01096P

• Product Name:
• Rabbit anti-Human SCFD1 Polyclonal Antibody

• Synonym:
• SLY1; RA410; SLY1P; STXBP1L2; C14orf163; SCFD1

• Description:
• The antibody against SCFD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 373-642 of human SCFD1 (NP_057190.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 373-642 of human SCFD1 (NP_057190.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SCFD1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SMLSDNTAKLTSAVSSLPELLEKKRLIDLHTNVATAVLEHIKARKLDVYFEYEEKIMSKTTLDKSLLDIISDPDAGTPEDKMRLFLIYYISTQQAPSEADLEQYKKALTDAGCNLNPLQYIKQWKAFTKMASAPASYGSTTTKPMGLLSRVMNTGSQFVMEGVKNLVLKQQNLPVTRILDNLMEMKSNPETDDYRYFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGKHILYGCSELFNATQFIKQLSQLGQK

• Gene ID:
• 23256

• Uniprot-ID:
• Q8WVM8

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, A-431, 293T, 22Rv1, DU145, Mouse liver, Mouse kidney, Rat liver