Rabbit anti-Human SART3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02182P

• Product Name:
• Rabbit anti-Human SART3 Polyclonal Antibody

• Synonym:
• P100; p110; DSAP1; TIP110; p110(nrb); RP11-13G14; SART3

• Description:
• The antibody against SART3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 664-963 of human SART3 (NP_055521.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 664-963 of human SART3 (NP_055521.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SART3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK

• Gene ID:
• 9733

• Uniprot-ID:
• Q15020

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, A-431, HeLa, HepG2, Jurkat