Rabbit anti-Human SARM1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07515P

• Product Name:
• Rabbit anti-Human SARM1 Polyclonal Antibody

• Synonym:
• SARM; HsTIR; SAMD2; hSARM1; MyD88-5; SARM1

• Description:
• The antibody against SARM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 625-724 of human SARM1 (NP_055892.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 625-724 of human SARM1 (NP_055892.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SARM1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAPMGPT

• Gene ID:
• 23098

• Uniprot-ID:
• Q6SZW1

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, SH-SY5Y