Rabbit anti-Human S1PR3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04921P

• Product Name:
• Rabbit anti-Human S1PR3 Polyclonal Antibody

• Synonym:
• EDG3; LPB3; S1P3; EDG-3; C9orf47; C9orf108; bA791O21.3; S1PR3

• Description:
• The antibody against S1PR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human S1PR3 (NP_005217.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human S1PR3 (NP_005217.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• S1PR3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFC

• Gene ID:
• 1903

• Uniprot-ID:
• Q99500

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse heart, Mouse kidney