Rabbit anti-Human S100A12 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06349P

• Product Name:
• Rabbit anti-Human S100A12 Polyclonal Antibody

• Synonym:
• p6; CAGC; CGRP; MRP6; CAAF1; MRP-6; ENRAGE; S100A12

• Description:
• The antibody against S100A12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A12 (NP_005612.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A12 (NP_005612.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• S100A12

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

• Gene ID:
• 6283

• Uniprot-ID:
• P80511

• Purification Method:
• Affinity purification