Rabbit anti-Human S100A11 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13165P

• Product Name:
• Rabbit anti-Human S100A11 Polyclonal Antibody

• Synonym:
• MLN70; S100C; HEL-S-43; 11

• Description:
• The antibody against S100A11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• S100A11

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

• Gene ID:
• 6282

• Uniprot-ID:
• P31949

• Purification Method:
• Affinity purification

• Positive Samples:
• BxPC-3, BT-474, LOVO, 22Rv1, SKOV3, THP-1