Rabbit anti-Human RXFP4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00568P

• Product Name:
• Rabbit anti-Human RXFP4 Polyclonal Antibody

• Synonym:
• GPR100; RLN3R2; RXFPR4; GPCR142; RXFP4

• Description:
• The antibody against RXFP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 305-374 of human RXFP4 (NP_871001.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 305-374 of human RXFP4 (NP_871001.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RXFP4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG

• Gene ID:
• 339403

• Uniprot-ID:
• Q8TDU9

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, Mouse brain, Mouse kidney