Rabbit anti-Human RPS6KA2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10447P

• Product Name:
• Rabbit anti-Human RPS6KA2 Polyclonal Antibody

• Synonym:
• RSK; HU-2; RSK3; p90RSK2; p90-RSK3; pp90RSK3; MAPKAPK1C; S6K-alpha; S6K-alpha2; RPS6KA2

• Description:
• The antibody against RPS6KA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 632-733 of human RPS6KA2 (NP_066958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 632-733 of human RPS6KA2 (NP_066958.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RPS6KA2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL

• Gene ID:
• 6196

• Uniprot-ID:
• Q15349

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, A-549, U-87MG, PC-12, Mouse brian, Mouse heart, Rat brain