Rabbit anti-Human RPS25 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11386P

• Product Name:
• Rabbit anti-Human RPS25 Polyclonal Antibody

• Synonym:
• S25; eS25; RPS25

• Description:
• The antibody against RPS25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human RPS25 (NP_001019.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human RPS25 (NP_001019.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RPS25

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA

• Gene ID:
• 6230

• Uniprot-ID:
• P62851

• Purification Method:
• Affinity purification

• Positive Samples:
• A431, BxPC-3, A549, HeLa, K-562, Mouse liver, Mouse pancreas, Rat liver