Rabbit anti-Human RPL36AL Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08834P

• Product Name:
• Rabbit anti-Human RPL36AL Polyclonal Antibody

• Synonym:
• RPL36A; RPL36AP42; RPL36A_18_1363; RPL36AL

• Description:
• The antibody against RPL36AL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human RPL36AL (NP_000992.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human RPL36AL (NP_000992.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RPL36AL

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF

• Gene ID:
• 6166

• Uniprot-ID:
• Q969Q0

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, A-549, HeLa, Jurkat, Mouse kidney, Mouse lung