Rabbit anti-Human RPE65 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08408P

• Product Name:
• Rabbit anti-Human RPE65 Polyclonal Antibody

• Synonym:
• p63; BCO3; LCA2; RP20; rd12; mRPE65; sRPE65; RPE65

• Description:
• The antibody against RPE65 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 340-440 of human RPE65(NP_000320.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 340-440 of human RPE65(NP_000320.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RPE65

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLN

• Gene ID:
• 6121

• Uniprot-ID:
• Q16518

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse eye