Rabbit anti-Human RNPEP Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04010P

• Product Name:
• Rabbit anti-Human RNPEP Polyclonal Antibody

• Synonym:
• APB; AP-B; RNPEP

• Description:
• The antibody against RNPEP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 371-650 of human RNPEP (NP_064601.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 371-650 of human RNPEP (NP_064601.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RNPEP

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EAATGRALLRQHMDITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDSFLKAYVHEFKFRSILADDFLDFYLEYFPELKKKRVDIIPGFEFDRWLNTPGWPPYLPDLSPGDSLMKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS

• Gene ID:
• 6051

• Uniprot-ID:
• Q9H4A4

• Purification Method:
• Affinity purification

• Positive Samples:
• NCI-H460, U-251MG, HepG2, HeLa, HL-60, Mouse kidney, Mouse brain, Rat testis, Rat liver