Rabbit anti-Human RhoA Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06583P

• Product Name:
• Rabbit anti-Human RhoA Polyclonal Antibody

• Synonym:
• ARHA; ARH12; RHO12; EDFAOB; RHOH12; [KD Validated] RhoA

• Description:
• The antibody against RhoA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 94-193 of human RhoA (NP_001655.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 94-193 of human RhoA (NP_001655.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RhoA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

• Gene ID:
• 387

• Uniprot-ID:
• P61586

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, HUVEC, PC-12, Mouse brain