Rabbit anti-Human RGS20 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01756P

• Product Name:
• Rabbit anti-Human RGS20 Polyclonal Antibody

• Synonym:
• RGSZ1; ZGAP1; gz-GAP; g(z)GAP; RGS20

• Description:
• The antibody against RGS20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-241 of human RGS20 (NP_003693.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-241 of human RGS20 (NP_003693.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RGS20

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA

• Gene ID:
• 8601

• Uniprot-ID:
• O76081

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, NIH/3T3, SKOV3, HeLa, A-549, Mouse brain, Mouse spinal cord, Rat brain