Rabbit anti-Human Reptin/RUVBL2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11885P

• Product Name:
• Rabbit anti-Human Reptin/RUVBL2 Polyclonal Antibody

• Synonym:
• RVB2; TIH2; ECP51; TIP48; CGI-46; ECP-51; INO80J; REPTIN; TIP49B; TAP54-beta; Reptin/RUVBL2

• Description:
• The antibody against Reptin/RUVBL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-463 of human Reptin/Reptin/RUVBL2 (NP_006657.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-463 of human Reptin/Reptin/RUVBL2 (NP_006657.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Reptin/RUVBL2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

• Gene ID:
• 10856

• Uniprot-ID:
• Q9Y230

• Purification Method:
• Affinity purification

• Positive Samples:
• BT-474, K-562, SW480, MCF-7, 22Rv1, 293T