Rabbit anti-Human REEP5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01472P

• Product Name:
• Rabbit anti-Human REEP5 Polyclonal Antibody

• Synonym:
• DP1; TB2; YOP1; POB16; Yip2e; D5S346; C5orf18; REEP5

• Description:
• The antibody against REEP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• REEP5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

• Gene ID:
• 7905

• Uniprot-ID:
• Q00765

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, LO2, A375, MCF7, Mouse brain, Mouse heart, Mouse pancreas, Rat brain, Rat heart