Rabbit anti-Human REEP2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06087P

• Product Name:
• Rabbit anti-Human REEP2 Polyclonal Antibody

• Synonym:
• SPG72; Yip2d; C5orf19; SGC32445; REEP2

• Description:
• The antibody against REEP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 93-252 of human REEP2 (NP_057690.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 93-252 of human REEP2 (NP_057690.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• REEP2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA

• Gene ID:
• 51308

• Uniprot-ID:
• Q9BRK0

• Purification Method:
• Affinity purification

• Positive Samples:
• RD, Mouse brain, Mouse testis, Rat testis