Rabbit anti-Human RBP3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03043P

• Product Name:
• Rabbit anti-Human RBP3 Polyclonal Antibody

• Synonym:
• IRBP; RBPI; RP66; D10S64; D10S65; D10S66; RBP3

• Description:
• The antibody against RBP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-320 of human RBP3 (NP_002891.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 18-320 of human RBP3 (NP_002891.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RBP3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GPTHLFQPSLVLDMAKVLLDNYCFPENLLGMQEAIQQAIKSHEILSISDPQTLASVLTAGVQSSLNDPRLVISYEPSTPEPPPQVPALTSLSEEELLAWLQRGLRHEVLEGNVGYLRVDSVPGQEVLSMMGEFLVAHVWGNLMGTSALVLDLRHCTGGQVSGIPYIISYLHPGNTILHVDTIYNRPSNTTTEIWTLPQVLGERYGADKDVVVLTSSQTRGVAEDIAHILKQMRRAIVVGERTGGGALDLRKLRIGESDFFFTVPVSRSLGPLGGGSQTWEGSGVLPCVGTPAEQALEKALAIL

• Gene ID:
• 5949

• Uniprot-ID:
• P10745

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung, Mouse eye, Rat eye