Rabbit anti-Human RbAp46/RBBP7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06234P

• Product Name:
• Rabbit anti-Human RbAp46/RBBP7 Polyclonal Antibody

• Synonym:
• RbAp46; RbAp46/RBBP7

• Description:
• The antibody against RbAp46/RBBP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RbAp46/RBBP7 (NP_002884.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RbAp46/RBBP7 (NP_002884.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ChIP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RbAp46/RBBP7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVE

• Gene ID:
• 5931

• Uniprot-ID:
• Q16576

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, NIH/3T3, Mouse placenta, Rat spleen