Rabbit anti-Human RARβ Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08693P

• Product Name:
• Rabbit anti-Human RARβ Polyclonal Antibody

• Synonym:
• HAP; RRB2; NR1B2; MCOPS12; RARbeta; RARbeta1; RARβ

• Description:
• The antibody against RARβ was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-340 of human RARβ (NP_057236.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-340 of human RARβ (NP_057236.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RARβ

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ

• Gene ID:
• 5915

• Uniprot-ID:
• P10826

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, BT-474, NCI-H460