Rabbit anti-Human Raf1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08118P

• Product Name:
• Rabbit anti-Human Raf1 Polyclonal Antibody

• Synonym:
• NS5; CRAF; Raf-1; c-Raf; CMD1NN; [KD Validated] Raf1

• Description:
• The antibody against Raf1 was raised in Rabbit using the recombinant protein of human Raf1 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human Raf1.

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Raf1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVM

• Gene ID:
• 5894

• Uniprot-ID:
• P04049

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, Mouse lung