Rabbit anti-Human Rad50 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10406P

• Product Name:
• Rabbit anti-Human Rad50 Polyclonal Antibody

• Synonym:
• NBSLD; RAD502; hRad50; Rad50

• Description:
• The antibody against Rad50 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-270 of human Rad50 (NP_005723.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-270 of human Rad50 (NP_005723.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Rad50

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLTSSKEIVKSYENELDPLKNRLKEIEHNLSKIMKLDN

• Gene ID:
• 10111

• Uniprot-ID:
• Q92878

• Purification Method:
• Affinity purification

• Positive Samples:
• NIH3T3, MCF-7, A-549, HT-29, Mouse lung